5764
showing only twitter [see all]
Jeff | Lesley University - University Hall
Porter Sq Intersection Inprovekents meeting (@ Lesley University - University Hall in Cambridge, MA)
from twitter
14 hours ago
Beyond the Bitcoin Bubble - NYTimes.com
RT : Fantastic piece, simply written, on the promise of blockchains:
from twitter
18 hours ago
Twitter
Come out tonight if you want to learn about, or offer comments on, Porter Sq & how its intersection can be safer an…
from twitter
19 hours ago
Twitter
RT : Why isn't this already a permanent change on the SL?
from twitter
yesterday
Twitter
RT : Tonight, the new Warming Center located at the Citywide Senior Center in Central Square will open its doors for the…
from twitter
2 days ago
Twitter
Damned Twitter, changing my URLS. One is with the www subdomain, which works with the SSL cert.…
from twitter
2 days ago
Transit Hubs: A Growing Lure for Developers - The New York Times
RT : Remember when we used to build our cities around train stations? We’re at it again. The talks TOD.
from twitter
2 days ago
Twitter
RT : Brilliant rundown of why we YIMBY:

"The bill may be the biggest environmental boon, the best job creator, and the…
from twitter
2 days ago
Twitter
hey, so your website breaks after trying to log in. Lots of 500 errors & JS errors. Sa…
from twitter
2 days ago
Login to MyADP
hey, so your website breaks after trying to log in. Lots of 500 errors & JS errors. Sa…
from twitter
2 days ago
Twitter
RT : "It would cost residents approximately $26 a year in taxes for the City to take on sidewalk snow maintenance and I’…
from twitter
3 days ago
Twitter
RT : As you honor my father today, please remember and honor my mother, as well. She was the architect of the King Legac…
from twitter
3 days ago
Twitter
RT : The press seems to be pressing to have the person who caused this error to be fired.

I say “NO.” The person who…
from twitter
3 days ago
Twitter
RT : The Omoshiro ("fun") Block is a note pad that excavates well-known Japanese landmarks as they're used…
from twitter
3 days ago
Twitter
RT : Would you be willing to retweet this? “We all know the phrase ‘Yes, but’ really means ‘No, and here’s why you’re wr…
from twitter
3 days ago
Twitter
♫ My Top 5 artists: Béla Fleck and the Flecktones (15), Esbjörn Svensson Trio (12), Paolo Fresu Quintet (12…
lastfm  from twitter
4 days ago
Twitter
RT : Donald Trump’s State of the Union speech is on January 30th.

He’s obsessed by TV ratings.

America - don’t watch…
from twitter
4 days ago
Twitter
RT : A state senator from San Francisco recently filed aggressive housing legislation that should be envy of thriving re…
from twitter
4 days ago
Twitter
RT : Lot of folks, from the alt-right to , think they’re making a great argument in the president’s defense to…
from twitter
4 days ago
Twitter
RT : The key is to let trump self-destruct, and take the party down with him, without taking the country with him. An ac…
from twitter
6 days ago
Twitter
RT : This, rather than fantasies of impeachment (or, god forbid, the 25th amendment) are the way to burn the nascent aut…
from twitter
6 days ago
Twitter
RT : The way to defeat Trump is through a massive electoral victory in the midterms. Make the Republican Party pay a hor…
from twitter
6 days ago
Twitter
RT : How about year round cycling. This was submitted 11 months ago. and would rather promote…
from twitter
6 days ago
Twitter
RT : there’s an old saying that “power corrupts.” i’ve never found that to be true. there’s plenty of powerful people wh…
from twitter
6 days ago
Twitter
RT : Reminder: Donald Trump is, and always has been, a racist. by
from twitter
6 days ago
Origins of the Sicilian Mafia: The Market for Lemons
Apparently the mafia arose b/c citrus fruit was a big deal in 19th C. Italy:
from twitter
6 days ago
Twitter
This is a place to live that I would enjoy paying for at market rates. Thrilled that it’s…
from twitter
6 days ago
Twitter
RT : Thrilled that this project was approved, but it shouldn’t be this hard. Affordable housing should have a by-right a…
from twitter
6 days ago
Twitter
RT : 100% in Porter Sq!

It’s not in , but it’s right next door & housing is a regional need.…
affordablehousing  VilleMA  from twitter
7 days ago
Twitter
Hah! I just tweeted exactly that.

Wish I’d known you were there, I discovered your transit blog…
from twitter
7 days ago
Twitter
RT : Cambridge BZA approves CH.40B Comprehensive Permit for 1791 Mass Ave., by unanimous vote 5-0.
40 units of 100% affo…
from twitter
7 days ago
Twitter
Board demonstrated clear biases tonight against this p…
from twitter
7 days ago
Twitter
RT : The primaries start as early as March in some states.

Please make sure you are able to vote! We need you!

Find…
from twitter
7 days ago
Twitter
Cambridge Board of Zoning Appeals meeting to speak in favor of 1791 Mass Ave (@ Cambridge Senior…
affordablehousing  from twitter
7 days ago
Twitter
RT : Perhaps even more important than your letters is showing up at **tonight's** zoning board meeting to speak in suppo…
from twitter
7 days ago
Twitter
RT : Thanks to the many of you that have already sent emails to the zoning board in support of the proposed transit-orie…
from twitter
7 days ago
Twitter
RT : The supply of more housing has helped to slow down the rise of rents in Boston. Good news. We need more transit-ori…
from twitter
7 days ago
Twitter
RT : Lets not do the same thing to Alewife. Opposing new construction along the T forces people to exurbs not served by…
from twitter
7 days ago
Dram Night [01/05/18]
looks like this event: got the Octobussy event’s picture. Oops!
from twitter
7 days ago
Twitter
RT : Here’s a weird one for you: Last week, I called out my former boss for sexual harassment, and today I’m…
from twitter
7 days ago
Twitter
RT : There are roughly a billion things to love about this exchange between and the .
from twitter
7 days ago
Twitter
RT : Join us and the MA community at the stop in ! tomorrow - Thursday, January…
GreatNeighborhoodsMA  Winthrop  TODrinks  from twitter
8 days ago
Twitter
Wait… in the App Store app? That’s strange, b/c mine looks (and always has looked) like this:
from twitter
8 days ago
Meet Jay Gonzalez, candidate for Governor, Sun. Jan. 14 @ 12pm
RT : Meet Jay Gonzalez, candidate for Governor, Sun. Jan. 14 @ 12pm — 
from twitter
8 days ago
Twitter
RT : the stack overflow dev survey is out and i just took it. they could use better representation of all of us in the r…
from twitter
8 days ago
Twitter
Hey , looks like has caught on to what you already know!
from twitter
8 days ago
Twitter
RT : How great cities enable you to live longer
from twitter
9 days ago
Twitter
We’ve got a goal to add 125 new acres of open space (defined as parks, fields, &c.)

And yes,…
SomerVision  from twitter
9 days ago
Twitter
Yep. We’ve got one of those for our building (it is, however, a little garden).

It’s nice, but I’d trade i…
from twitter
9 days ago
Twitter
I have not, but I agree. Stuy Town/Peter Cooper Village is incredibly guilty of using greenspace in this fa…
from twitter
9 days ago
Twitter
Or, in the case of Stuy Town/Peter Cooper Village, towers surrounded by tiny, unusable gardens.

Put _all_…
from twitter
9 days ago
Twitter
RT : The City of Cambridge permitted only 297 new housing units last year. That's less than Sharon, Plymouth, Framingha…
from twitter
9 days ago
Twitter
Quotes!

“…Percelay says he still sees opportunity for mid-priced apartments.

‘The demand fo…
from twitter
9 days ago
Twitter
RT : I've been asked a few times recently by other YIMBY orgs about advice on dealing with reporters. I'm not an expert,…
from twitter
9 days ago
Twitter
My sister lived in Peter Cooper Village (one part of Stuy Town), and I tell you this: it is _distinctly_ an…
from twitter
9 days ago
Twitter
RT : Spreading civic literacy; supporting democratic culture; providing people with the insight to voice their grievance…
from twitter
9 days ago
Twitter
RT : Trivializing democracy; being anti-government; claiming all politicians are evil; saying there are no differences b…
from twitter
9 days ago
Twitter
RT : New post -->

I started working on diversity change on my team last year around this time at Shopify and I tweeted…
from twitter
9 days ago
Twitter
RT : This Thursday, Jan 11th - join us for in Winthrop! Meet neighbors and discuss in your commun…
TODrinks  SmartGrowth  from twitter
9 days ago
Twitter
Getting real deep over there at .

Kudos to all your hard work, and sorry to see it go. Hope…
from twitter
9 days ago
Twitter
a heads-up, your status page might need an update:
from twitter
9 days ago
Twitter
I finally have an answer for you: wtf is a load balancer?
from twitter
10 days ago
Twitter
RT : NASA just released these 8 images of Jupiter taken by the Juno spacecraft, the highest resolution, most color detai…
from twitter
10 days ago
Twitter
♫ My Top 5 artists: 65daysofstatic (13), Tony Bennett Feat. Count Basie & His Orchestra (10), Jackie McLean…
lastfm  from twitter
11 days ago
Twitter
RT : This is a credible bit of work. "I’ve Studied the Trump-Fox Feedback Loop for Months. It’s Crazier Than You Think."…
from twitter
12 days ago
Twitter
RT : Genuine comment tho: I think a lot of people wish he would.

Sound off if you're a YIMBY outside of CA having major…
from twitter
13 days ago
Twitter
RT : PSA for not-tech people:

- Practically ALL desktop computers can now get a virus by simply visiting ANY website. A…
from twitter
13 days ago
Twitter
RT : The routes on that map could make up an incredible network of bus priority lanes or protected cycletracks, if we di…
from twitter
13 days ago
Twitter
RT : Photo of the decade: Doug Jones being sworn in, while his openly gay son QUIETLY DISINTEGRATES THE SOUL OF MIKE PEN…
from twitter
13 days ago
Twitter
RT : Periodic PSA: if you have an older Mac, and High Sierra feels laggy and slow, *it's the stock video drivers.*

NVID…
from twitter
13 days ago
« earlier      
#blackfriday #dailydeal #gropefree #itunes #jb #netneutrality #starwars #swagapalooza #taxes #thenillseeyouinhell 101 1988ceo 2future4u 50onfirebos 50shadesofbrown 60toast 8217 about absolutelyyes accounting ads advice aeachi aggregator aggressivehospitality airline airstream ajax almostsisters alumnilove and apache apartments article articles awesome babyblock background band bargains bass batman bestpractice bigwreck bitters bittorrent blackfriday blessed blizzard2015 blockquote blog blogging blueprint bluetux bocouproost bodog bookmarks bosnow bosto boston bostonberkleereunion bostoneers bostonfest bostonstrong bourbon bowtie box-shadow branding brilliant browser burnnotice busin business cache calendar cambma casenais- catalogs catapult cd-ripping ceac2013 cheatsheet chickistoast chiptune civil-war cl clothing cloud cms cocktail cocktailclub cocktails code code-compression comfortfood comiccon comments comparison computer concert confederacy contact contacts conversion coolhackbro credit css css-specificity culture custom customize daily-sites dailydeal dailyfail database datarage datepicker dave dbtechprom deal deal30 deals debt deficit delay denim design details dev development devopsisawasteland directory dmb dns dock documents domain domains donereading dotd drinkone drinksontap drop-shadow dyingera dynamodb ecig editor education eecms elizabeth elpelon em email ettajames events everassassins evercrew everparty evertrue exhausted expressionengine extensions facebook familytime fancyfriday fatt favicon festivalofsnow filter finance financial finerthings firefox firstdayofspring flash flashbackfriday flight forms forser framework free freefont freelance freeparking freshpot frostydelicious fugq fun funny futurecollaboration gallery gcal generator getb ghostbusters git gmail golden goldengiobes gonova googlemaps goptakeover gosox grid gropefree gtd hackbrown happy hard-drive hcr healthcare highlighter hipchatbeta hive hobokenfirefighters holycowthatischeap homeland housing how-to howto htaccess html html5 humor ical icann icons ifttt ilyemail images imap in inbox ink inspiration install installer internet invoice invoicing ios ipa iphone italics13 itswhatjedisdrink itunes jamaicaplain japanesewhisky javascript jazz jb job jobs joinus jp jquery julep julepshavesprung junkmail juno2015 justreadit katespade kickstarter kitchenci ladies lamb lambjam lamp language lastfm layout leadership leahsbach legal leopard letsdrink lgbtq library lifehacker lifehacks lightbox linguistics links listen loadtesting lookup loremipsum love loveatfirstclick mac mac-os-x mac-pro macstoriesdeals mail management maps mario markdown marketing markup martinimonday mashup matthews mbta menswear mezcal mlb mobile mod_rewrite mootools morethanjustadream moving mp3 mp3_ mtvoma music music_ musicmonday mysql nannannannnannan narro negroniweek nemo netneutrality newmastersounds newtown nexus nifty nintendo nra nutball12 obamacare occupy occupywallstreet ocearch oink oldfashioned on onebostonday onedollarwednesday onthebar ops opschef optimization optout organization oscars osx overflow p2p pagination pair pay-for-clicks pennyarcade performance personal phonebook photo photography photoshop php ping.fm plugin policy politics productivity psychology punchdrunkmonday quotes raid raisetherim read realestate recording records redwhiteandblue reference relaxation rememberthemilk repealday requiredreading reset resource rip roostboston rss rubyfornubies s/t sailing sandy sass sata saturdayselfie savejon savethedata savinglives science search selfie series shabbatshasnow sharing sharktracker shirts shoottothrill shopping skyfall smithandwollensky snes sobeautiful socialskills software sop sopa sound soundcloud soundtracking sprite sprites stacks standards startup startuplife starwars storage style stylus suits sunday supernatural swagapalooza swearing sync t-shirts tables tacky takemymoneyhbo taxes taxilicious tea-party techgivesback technology tedc13 templates testing text-shadow thankssteve the theamericans thebachelor thefreshgeek thenillseeyouinhell thething thickbox thirstboston thisishowyoudoit thorntonsthursday thumbnails tikituesday tips to tool toolbar tools toread trackback trackbacks tracking travel trees trending triplets trueblood truegame truepartner turducken tutorial tutorials tux tuxedo tv tweaks tweetfest09 twitter txjs typeface typography umbrellas upgrade usa usability useful usefulornifty utilities vacationgram veevee video videos vote vscocam weaselpecker web web-2.0 web-apps web-design web-development web-stuff web2.0 webdesign webdev wedding weeklywhiskey whackywavingflailingarmflailingtubeman whiskey whiskeylist whisky whiskylive whois whoyougoingtocall whoyougonnacall windows windsorcustom wine wingmanapproved wmda11 woc women wordpress workw wrong wtf wwbos wwdc wysiwym xact yelp youtube zeroday zombiejesus

Copy this bookmark:



description:


tags: