7655
showing only twitter [see all]
Twitter
RT : If this is your first time seeing this graph, you have friends who haven’t seen it yet. Share far and wide. h/t…
from twitter
22 hours ago
Twitter
RT : good thread on imagining a mythical, racially homogenous past and projecting it back on americans. you re…
from twitter
yesterday
Twitter
RT : What's it like to develop affordable housing in ?

Well ... in past few yrs, City's tried to develop *50* si…
cambma  from twitter
yesterday
Twitter
Absolutely. But it needs to allow market devs both independently and as part of uni development…
from twitter
yesterday
Twitter
RT : Gun control originally began as a mechanism to suppress the Black civil rights movements (plural, yes, because the…
from twitter
yesterday
Twitter
RT : another reason why we need more homes: as prices rise due to a lack of supply, people get trapped in toxic living s…
from twitter
yesterday
Twitter
RT : Indiana purged 460k voters.

Georgia is freezing 50k newly registered Black voters

North Dakota is disenfranchisi…
from twitter
yesterday
Twitter
RT : Lotsa data dropped in 2019 preview at but this jumped out at me. Construction costs worry housing develope…
ULIFall  from twitter
yesterday
Twitter
Without relaxing or exempting them from zoning regulations, it would have zero impact in places…
from twitter
yesterday
Twitter
RT : “If we split the nation’s combined wealth equally among households, the country has enough money for every family t…
from twitter
yesterday
Twitter
RT : Huge. Give students the housing they need and free up family housing for families.
from twitter
2 days ago
Twitter
RT : Okay so I'm a youth worker, and therefore have to deal with youth safety policies.

So I'm going to talk for a sec…
from twitter
3 days ago
Twitter
RT : Here’s the interior of the old 1963 Pullman Standard 1400 series trains from the Red Line. Taken out…
MBTA  Boston  from twitter
3 days ago
Twitter
RT : abducted not adopted
abducted not adopted
abducted not adopted
from twitter
3 days ago
Twitter
RT : Legendary fighter of exclusionary zoning, Paul Davidoff, called to abolish the following practices in 1971. YIMBYs…
from twitter
3 days ago
Twitter
RT : 1. Brian Kemp is running for GA gov against Stacey Abrams (a black woman)
2. Kemp is in charge of elections & vote…
from twitter
3 days ago
Twitter
RT : "Amazon's system taught itself that male candidates were preferable." No. This is not what happened. Amazon taught…
from twitter
3 days ago
Twitter
RT : I don't know of any Great Slate candidate polling as poorly as Beto, and yet an enormous amount of money is pouring…
from twitter
3 days ago
Twitter
RT : Please consider coming out to support 23 new homes on Green Street (including 4 affordable) at the Egleston YMCA on…
from twitter
3 days ago
Twitter
RT : I'm so tired of mental health discussions being centered around individual social connection instead of
a) funding…
from twitter
4 days ago
Nest 2nd Generation Learning Silver Programmable Thermostat 854448003051 | eBay
In case anybody’s interested, I’m selling a Nest 2nd generation thermostat:
from twitter
5 days ago
Twitter
RT : 100 companies are responsible for 71% of global emissions

100 companies are responsible for 71% of global emissio…
from twitter
5 days ago
Twitter
Yah, definitely need more parking, and closer! There’s a big pen down th…
from twitter
5 days ago
Twitter
RT : *Looks* at the small new housing pledge by 15 Greater Boston municipal leaders. CC:
mapoli  from twitter
5 days ago
Twitter
RT : Today is the LAST day to register to vote if you live in:
AZ
AR
FL
GA
IN
KY
LA
MI
MS
NM
NV
OH
PA
TN
or the great…
from twitter
6 days ago
Twitter
Yep. That is the biggest piece: understanding that what we do _does_ matter, but knowing _where_ to do i…
from twitter
6 days ago
Twitter
RT : If you live in New York and want to change your party registration, the deadline to do so for the *2019* elections…
from twitter
6 days ago
Twitter
RT : I call this the Beto effect. Hard to believe but many Dem candidates are underfunded because the party is.. well, i…
from twitter
6 days ago
Twitter
RT : I wrote an impassioned cri de nerd here about why we risk losing the midterms. I'll spruce it up with hyperlinks an…
from twitter
6 days ago
Twitter
Indeed.

But we offer subsidies for folks to add solar, to replace their win…
from twitter
6 days ago
Twitter
It’s true, electric heat is pricey, relative to gas.

That’s thanks, of cour…
from twitter
6 days ago
Twitter
RT : Little reminder that a week ago news broke that the President and his family committed something like a half billio…
from twitter
6 days ago
Twitter
Hey friends, if you’re not registered, and you live in one of these states:

REGISTER!

And double check your regis…
from twitter
6 days ago
Twitter
Considering how much more improved induction cooktops are, we really don’t have any goo…
from twitter
6 days ago
Twitter
Alongside the housing justice that being a is about, there is also environmental justice, and this thread la…
YIMBY  from twitter
6 days ago
Twitter
RT : The moderate position is we require every city to be twice as dense as they are today. The extremist position is we…
from twitter
7 days ago
Twitter
RT : I'm a moderate on climate change. The moderate position is massive government intervention into the economy.

The…
from twitter
7 days ago
Twitter
RT : This is the only thread you need to read today.
It puts both-siderism into a shallow unmarked grave.
from twitter
7 days ago
Twitter
♫ My Top 5 artists: Roosevelt (12), Oscar Peterson Trio (10), Jesse Fischer (7), Christian McBride (4) & Mi…
lastfm  from twitter
7 days ago
Twitter
RT : This is the first US Senate seat EVER to be decided using ranked-choice voting.

That means there’s no spoiler effe…
from twitter
7 days ago
Twitter
RT : Howard Zinn: “Don't Despair About the Supreme Court”
from twitter
7 days ago
Twitter
RT : Good piece in the special transportation section from on the need for smart planing and po…
from twitter
7 days ago
Relax, Ladies. Don’t Be So Uptight. You Know You Want It
RT : “Ask yourself: What strongly held opinion of mine will my grandchildren one day struggle to understand?”
from twitter
7 days ago
Twitter
RT : I remember Anita Hill saying how all the cards she received meant so much to her, let’s do the same for Dr Ford. 💛
from twitter
8 days ago
Twitter
RT : We are not a country “deeply divided.” We are a country where an extremist minority has seized power through anti-d…
from twitter
8 days ago
Twitter
RT : If you'd like to run for office in 2020, and you're a young, progressive candidate, in a (currently) red state -- m…
from twitter
8 days ago
Twitter
RT : My second request is that you take a portion of your very big tech paycheck and give it to 13 House candidates who…
from twitter
8 days ago
Twitter
RT : Twenty-seven years ago this month, Adam Gopnik wrote these words in a 1991 comment on the Clarence Thoma…
from twitter
8 days ago
Twitter
RT : In a world built for cars, it's tempting to say things would be simpler if cyclists would just follow the same rule…
from twitter
9 days ago
Twitter
RT : Susan Collins is not being blackmailed. She has not been bullied. She voted to preserve her perceived political pow…
from twitter
9 days ago
Twitter
RT : After 18 months at Sensu, I’m sad to announce I’m officially on the job market.

If anyone’s looking for a weird, e…
from twitter
9 days ago
Twitter
RT : Going to give some free publicity here: this is one of the best written SRE job listings I've ever seen!…
from twitter
9 days ago
Twitter
RT : Holy shit, Mad Magazine 👏👏👏
Pulling no punches.
from twitter
9 days ago
Twitter
RT : The funniest thing about Trump's inherited wealth is that he'd be way richer if he'd just stuck daddy's money in an…
from twitter
10 days ago
Twitter
RT : The overwhelming majority of men do not rape or try to rape people.
False accusations are incredibly rare.
Women k…
from twitter
11 days ago
Twitter
RT : Broke: bernie sanders got amazon to raise wages!
Woke: labor power & social pressure got amazon to raise wages!
Bes…
from twitter
11 days ago
Twitter
RT : This joint leadership is essential to getting us the housing supply we need for our full workforce, at prices peopl…
from twitter
11 days ago
Twitter
RT : Who is the M in NIMBY? How can we forge greater inclusivity around housing decisions? on Nov. 7 hosts…
from twitter
11 days ago
Twitter
Definitely don’t know anybody who spent a couple million on their home.

That sai…
from twitter
11 days ago
Twitter
I’ve not read them, but my impression of “Lean In” is unfavorable, based on what women…
from twitter
12 days ago
Twitter
RT : Pinning this so people don't have to hunt through my tweets:

—Sign up for the (low-volume) Great Slate mailing lis…
from twitter
12 days ago
Twitter
RT : Okay, I actually want to talk about this for a second, regarding millennials and how really goddamn difficult it is…
from twitter
12 days ago
Twitter
RT : What if what we call "Women's intuition" is actually the hyper vigilance and internalized analysis of your environ…
from twitter
12 days ago
Twitter
Same motivation that causes people to go nuts on a tax holiday, even though they’re only…
from twitter
12 days ago
Twitter
RT : You can tell this monstrosity was designed by a Californian
from twitter
12 days ago
Twitter
RT : Do you know how high the bar is for the NYT to directly accuse someone, let alone a sitting president, of tax fraud…
from twitter
12 days ago
Twitter
RT : "A housing emergency." Why, and how, 15 cities and towns at the core of Greater Boston plan to dramatically speed u…
from twitter
12 days ago
Twitter
RT : If the point of capitalism is to escape capitalism, then what’s the point of capitalism? Why don't we just give eac…
from twitter
12 days ago
Twitter
Oho! I like “résumé driven development”, heh.

I’ve tended to use the phrase when referring to someone bl…
from twitter
12 days ago
Twitter
RT : Please RT if you are a man who has never been in a bar fight.
from twitter
12 days ago
Twitter
Hmm. What do you think would better replace “cargo cult”? I’ve yet to figure that out for myself, though…
from twitter
12 days ago
Twitter
RT : You can now check out free mobile WiFi hotspots, and take them anywhere for up to three weeks, at Boston Public Lib…
from twitter
12 days ago
Untitled (https://www.youtube.com/watch?v=tg52up16eq0&feature=youtu.be&a)
I liked a video SPIDER-MAN: INTO THE SPIDER-VERSE - Official Trailer (HD)
from twitter
12 days ago
Twitter
RT : Here in Somerville, where 15 metro Boston mayors and managers are announcing an historic regional housing productio…
from twitter
12 days ago
Twitter
RT : This is why I get irritated when people are like, Democrats and Republicans are the same! Bruh, NO! An R in the Whi…
from twitter
12 days ago
« earlier      
#blackfriday #dailydeal #gropefree #itunes #jb #netneutrality #starwars #swagapalooza #taxes #thenillseeyouinhell 101 1988ceo 2future4u 50onfirebos 50shadesofbrown 60toast 8217 about absolutelyyes accounting ads advice aeachi aggregator aggressivehospitality airline airstream ajax almostsisters alumnilove and apache apartments article articles awesome babyblock background band bargains bass batman bestpractice bigwreck bitters bittorrent blackfriday blessed blizzard2015 blockquote blog blogging blueprint bluetux bocouproost bodog bookmarks bosnow bosto boston bostonberkleereunion bostoneers bostonfest bostonstrong bourbon bowtie box-shadow branding brilliant browser burnnotice busin business cache calendar cambma casenais- catalogs catapult cd-ripping ceac2013 cheatsheet chickistoast chiptune civil-war cl clothing cloud cms cocktail cocktailclub cocktails code code-compression comfortfood comiccon comments comparison computer concert confederacy contact contacts conversion coolhackbro credit css css-specificity culture custom customize daily-sites dailydeal dailyfail database datarage datepicker dave dbtechprom deal deal30 deals debt deficit delay denim design details dev development devopsisawasteland directory dmb dns dock documents domain domains donereading dotd drinkone drinksontap drop-shadow dyingera dynamodb ecig editor education eecms elizabeth elpelon em email ettajames events everassassins evercrew everparty evertrue exhausted expressionengine extensions facebook familytime fancyfriday fatt favicon festivalofsnow filter finance financial finerthings firefox firstdayofspring flash flashbackfriday flight forms forser framework free freefont freelance freeparking freshpot frostydelicious fugq fun funny futurecollaboration gallery gcal generator getb ghostbusters git gmail golden goldengiobes gonova googlemaps goptakeover gosox grid gropefree gtd hackbrown happy hard-drive hcr healthcare highlighter hipchatbeta hive hobokenfirefighters holycowthatischeap homeland housing how-to howto htaccess html html5 humor ical icann icons ifttt ilyemail images imap in inbox ink inspiration install installer internet invoice invoicing ios ipa iphone italics13 itswhatjedisdrink itunes jamaicaplain japanesewhisky javascript jazz jb job jobs joinus jp jquery julep julepshavesprung junkmail juno2015 justreadit katespade kickstarter kitchenci ladies lamb lambjam lamp language lastfm layout leadership leahsbach legal leopard letsdrink lgbtq library lifehacker lifehacks lightbox linguistics links listen loadtesting lookup loremipsum love loveatfirstclick mac mac-os-x mac-pro macstoriesdeals mail management maps mario markdown marketing markup martinimonday mashup matthews mbta menswear mezcal mlb mobile mod_rewrite mootools morethanjustadream moving mp3 mp3_ mtvoma music music_ musicmonday mysql nannannannnannan narro negroniweek nemo netneutrality newmastersounds newtown nexus nifty nintendo nra nutball12 obamacare occupy occupywallstreet ocearch oink oldfashioned on onebostonday onedollarwednesday onthebar ops opschef optimization optout organization oscars osx overflow p2p pagination pair pay-for-clicks pennyarcade performance personal phonebook photo photography photoshop php ping.fm plugin policy politics productivity psychology punchdrunkmonday quotes raid raisetherim read realestate recording records redwhiteandblue reference relaxation rememberthemilk repealday requiredreading reset resource rip roostboston rss rubyfornubies s/t sailing sandy sass sata saturdayselfie savejon savethedata savinglives science search selfie series shabbatshasnow sharing sharktracker shirts shoottothrill shopping skyfall smithandwollensky snes sobeautiful socialskills software sop sopa sound soundcloud soundtracking sprite sprites stacks standards startup startuplife starwars storage style stylus suits sunday supernatural swagapalooza swearing sync t-shirts tables tacky takemymoneyhbo taxes taxilicious tea-party techgivesback technology tedc13 templates testing text-shadow thankssteve the theamericans thebachelor thefreshgeek thenillseeyouinhell thething thickbox thirstboston thisishowyoudoit thorntonsthursday thumbnails tikituesday tips to tool toolbar tools toread trackback trackbacks tracking travel trees trending triplets trueblood truegame truepartner turducken tutorial tutorials tux tuxedo tv tweaks tweetfest09 twitter txjs typeface typography umbrellas upgrade usa usability useful usefulornifty utilities vacationgram veevee video videos vote vscocam weaselpecker web web-2.0 web-apps web-design web-development web-stuff web2.0 webdesign webdev wedding weeklywhiskey whackywavingflailingarmflailingtubeman whiskey whiskeylist whisky whiskylive whois whoyougoingtocall whoyougonnacall windows windsorcustom wine wingmanapproved wmda11 woc women wordpress workw wrong wtf wwbos wwdc wysiwym xact yelp youtube zeroday zombiejesus

Copy this bookmark:



description:


tags: