6457
showing only twitter [see all]
Twitter
RT : But somehow, after twists and turns:

- owns again
- owns
-
from twitter
10 hours ago
Twitter
RT : Years from now, the NFL will be embarrassed it kept a player out of the league for being a humanitarian.
from twitter
12 hours ago
Twitter
I was going to say this same thing. Consider it a once-in-a-lifetime gifting, and treat the…
from twitter
12 hours ago
Twitter
RT : We MUST be letting all the black and brown people out of jail who were thrown in there for marijuana and expunging…
from twitter
12 hours ago
Twitter
RT : As far as I’m concerned this is the most important news in New York City today. Congratulations to everyone who fou…
from twitter
13 hours ago
Twitter
RT : This is the high density urban hellscape liberals want.
from twitter
yesterday
Twitter
RT : We now have 2 top Democratic presidential candidates running on a plank.

And &…
JobsGuarantee  from twitter
yesterday
Twitter
RT : If developers are so f'ing powerful, why are the most effective proponents for urban living/housing this rag tag fl…
from twitter
2 days ago
Twitter
RT : If we don't like the outcomes we're getting in terms of housing development, we have to change the conditions under…
from twitter
2 days ago
Twitter
RT : Portland rents are flatlining amid an apartment construction boom - rents are actually dropping in 7 of the region'…
from twitter
2 days ago
Twitter
RT : I hear this over and over: devs are expected to learn in their spare time, participate in open source, attend meetu…
from twitter
2 days ago
Twitter
RT : There are so many nightmare statements in this one article.
from twitter
2 days ago
Twitter
RT : It's almost like increasing the supply of housing makes it cost less.
from twitter
2 days ago
Twitter
RT : How intergenerationally inequitable are property taxes in the county where I live?

50% of property taxes are paid…
from twitter
2 days ago
Twitter
RT : There really needs to be a semi exclamation point for when a period conveys too little enthusiasm in a work-related…
from twitter
2 days ago
Twitter
RT : We must protect the thousands of employees, families and visitors that bike across the Longfellow Bridge. This will…
from twitter
2 days ago
Twitter
your newsletter unsubscribe form is busted, and I cannot unsubscribe.

It doesn’t like the + charact…
from twitter
2 days ago
Boston Globe journalists discuss series on race in Harvard forum – Harvard Gazette
RT : This: “Liberal racism,” agreed Wen. “That is at the core of the Boston problem.” via
from twitter
3 days ago
Twitter
RT : Cynthia Nixon is the latest reminder that primary challenges are infinitely preferable to third party wank campaign…
from twitter
3 days ago
Jeff | Scullers Jazz Club
Here to see Trio! (at Club for Brad Mehldau Trio in Boston, MA)
from twitter
3 days ago
Twitter
RT : There's currently a dude playing roller hockey in the mostly empty parking lot behind the cvs in davis, in case you…
from twitter
3 days ago
Twitter
RT : Just want to note that whether or not 827 moves forward, SF can upzone near transit to its heart’s content. Includi…
from twitter
3 days ago
Twitter
RT : "Just before state senators voted on a landmark bill to ramp up housing production... legislator after legislator…
from twitter
3 days ago
Twitter
RT : The REAL reason we bombed Syria.

In case you’re wondering, the defense contractors who benefited gave $59.6M in lo…
from twitter
4 days ago
Twitter
RT : I find it appalling that people need to ask for basic safety measures from . This is for doctors, nurses,…
from twitter
4 days ago
Twitter
RT : HOT DAMN SOMEONE FINALLY NUTSHELLED IT
from twitter
4 days ago
Twitter
RT : The high winds in Southern California led to a takeover Victorville (📽️: James Quigg/)
Tumbleweed  from twitter
4 days ago
Twitter
RT : Breaking News: Starbucks will shut over 8,000 shops in the U.S. on May 29 for racial-bias training after the arrest…
from twitter
4 days ago
Twitter
RT : Get your eyes on the Davis Square Neighborhood Plan draft!

Monday, April 30th, 6 pm
Somerville Baptist Church
31 C…
from twitter
4 days ago
Twitter
RT : Meet the sixth-grade teacher JAY-Z credits with his love of language, Ms. Renee Rosenblum-Lowden now 77 spoke with…
from twitter
5 days ago
Twitter
RT : How Americans spend political energy:
90% Trump/federal
10% State
0% City/local

How we would spend…
from twitter
5 days ago
Twitter
RT : Do you know how stressful and exhausting it is to have to have race as part of your everyday "What am I going to do…
from twitter
5 days ago
Twitter
RT : “The worry isn’t ‘What happens if we train our people and they leave.’ I mean, the alternative is, ‘what happens if…
from twitter
5 days ago
Twitter
RT : Somerville is happy to partner with Good Egg Marketing to provide marketing and business management consulting serv…
from twitter
5 days ago
Twitter
RT : Subtle reminder that Sean Hannity made 36 million last year. He's the highest paid cable news personality in the en…
from twitter
5 days ago
Twitter
RT : I was in court yesterday and if it wasn’t for the attorney representing the press, Sean Hannity’s name would have b…
from twitter
5 days ago
Twitter
RT : The only thing shocking to me about the racism of employees is how shocked people are by it.

Y'all hav…
from twitter
6 days ago
Twitter
RT : Awesome: Transportation (), police () and fire () commissioners from…
from twitter
6 days ago
Twitter
RT : "Unlimited Paid Time Off" is Silicon Valley's version of the Marshmallow Test on its workers, testing their will an…
from twitter
6 days ago
Watch Beyonce's Full Set at Coachella 2018 | HipHop-N-More
RT : For colored girls (and boys) who set an alarm to catch Beychella, and still missed it:
from twitter
6 days ago
Twitter
RT : A journalist who exposed ties between ICE and local police and criticized the immigrant detention system is current…
from twitter
6 days ago
Twitter
RT : what do census tracts with highest concentrations of particular populations look like? work in progress
from twitter
6 days ago
Twitter
So just informed me that won the 2018 music & I honestly nearly wept.

A powe…
Pulitzer  from twitter
6 days ago
Twitter
RT : Dick’s is not fucking around:

“Typically a retailer returns unsold merchandise to the manufacturer. But Dick’s is…
from twitter
6 days ago
Twitter
RT : Testing a theory:
retweet if you're a white or white-presenting person and you've gone into a Starbucks and just u…
from twitter
6 days ago
Twitter
♫ My Top 5 artists: Lydian Collective (12), Frank Wunsch / Oliver Strauch Quintet feat. Kenny Wheeler & Ger…
lastfm  from twitter
6 days ago
Twitter
RT : Dick Cheney's daughter is running unopposed for Congress in Wyoming. She raised $70K in Q1 and has $82K cash on han…
from twitter
7 days ago
Twitter
RT : Difficult to fathom how outrageous this is.

For <1/2 the cost (€3.7b), Paris is extending RER E regional rail, wit…
from twitter
7 days ago
Twitter
RT : This is a fantastic aggregation of posts by Andrew Price, who has for years been pushing the idea of buying up a ci…
from twitter
7 days ago
Twitter
RT : The most important thing to remember here is this:

TRANS PEOPLE ARE NOT A DISTRACTION
&
TRANS PEOPLE ARE NOT A BUR…
from twitter
7 days ago
Twitter
RT : “The Court also rules that, because transgender people have long been subjected to systemic oppression and forced t…
from twitter
7 days ago
What Happens When You Ease Parking Requirements for New Housing — Nick Magrino
RT : How reducing parking requirements directly led to decreased housing costs in Minneapolis.
from twitter
7 days ago
Twitter
RT : Statement from Mayor McGovern regarding the unfortunate incident this past Friday night involving a Harvard student…
from twitter
7 days ago
Twitter
RT : White people: watch the Starbucks arrest video. See the white folks arguing with the police and asking why two inn…
from twitter
7 days ago
Twitter
RT : This is one of the most incredible temperature contrasts that i've seen in almost 2 decades of forecasting in .…
WNY  from twitter
8 days ago
Twitter
RT : Hey guys, I know I usually just post shitty jokes on my Twitter but bear with me because I wanted to share somethin…
from twitter
8 days ago
Twitter
RT : Mayor of one of the world’s great global cities just nonchalantly taking public transit. More of this please.
from twitter
8 days ago
Twitter
RT : Btw, it's not great when folks who study huge systems like climate, oceans+ ice sheets are surprised by how fast th…
from twitter
8 days ago
Twitter
RT : •Stop arming extremists to promote regime overthrow
•Stop bombing civilians—USA has killed 6,000 Syrians in the las…
from twitter
8 days ago
Twitter
RT : Wouldn’t it be great to welcome visitors from around the world to Boston with on weekend?…
OpenNewbury  Marathon  from twitter
8 days ago
Twitter
RT : For all the lip service paid to preserving form, the current rules (FAR limits, setback requirements, and especiall…
from twitter
8 days ago
Twitter
RT : I should also mention that I'm actively looking for my next gig. I still have nine months left on my term @ CFPB bu…
from twitter
9 days ago
Twitter
RT : Person A: Can we meet at Starbucks?
Person B: Sure see you there.
*Person B shows up, waits for Person A, gets cops…
from twitter
9 days ago
Twitter
RT : Works from 1923 enter the public domain in 2019! Copyright was extended in 1998 and that term in finally coming to…
from twitter
9 days ago
Twitter
RT : "No city can rely on federal funding, or its own funding, to build its way out of" affordability challenges, says…
from twitter
9 days ago
Twitter
RT : 🌱 ~ soft aesthetic ~

🌸 🌸

github org collecting my soft/cute/femme/cozy/etc themes for dev…
from twitter
9 days ago
~ soft aesthetic ~ · GitHub
RT : 🌱 ~ soft aesthetic ~

🌸 🌸

github org collecting my soft/cute/femme/cozy/etc themes for dev…
from twitter
9 days ago
Twitter
RT : If we want to build the pretty Viennese social housing that's all over this report, a necessary but insufficient st…
from twitter
9 days ago
Twitter
RT : Two things we aren't doing:
1. Upzoning near transit
2. Abolishing parking minimums
from twitter
9 days ago
Black teen misses bus, gets shot at after asking for directions in Rochester Hills - Story | WJBK
RT : Black teen misses bus, gets shot at after asking for directions in Rochester Hills
from twitter
9 days ago
Twitter
RT : If is so worried about losing younger fans, maybe they should focus less on shaving seconds off of game times…
from twitter
9 days ago
Twitter
RT : For any others in Boston and the surrounding area who are wondering why it sounds like a helicopter is closing in o…
from twitter
9 days ago
Twitter
RT : Developers don't drive up rent -- renters do. In any buy/sell equation, the purchasers drive up pric…
from twitter
9 days ago
Twitter
RT : People need to get over the idea that they're not "rich" when they own a home worth $1-2 million (or more), just be…
from twitter
10 days ago
Twitter
RT : Pretty much all of the last 4 centuries of classical woodworking and furniture design is a result of coping with th…
from twitter
10 days ago
Twitter
Bad news mate:

They’ve been trying to solve this signal problem all afternoon :(
from twitter
10 days ago
« earlier      
#blackfriday #dailydeal #gropefree #itunes #jb #netneutrality #starwars #swagapalooza #taxes #thenillseeyouinhell 101 1988ceo 2future4u 50onfirebos 50shadesofbrown 60toast 8217 about absolutelyyes accounting ads advice aeachi aggregator aggressivehospitality airline airstream ajax almostsisters alumnilove and apache apartments article articles awesome babyblock background band bargains bass batman bestpractice bigwreck bitters bittorrent blackfriday blessed blizzard2015 blockquote blog blogging blueprint bluetux bocouproost bodog bookmarks bosnow bosto boston bostonberkleereunion bostoneers bostonfest bostonstrong bourbon bowtie box-shadow branding brilliant browser burnnotice busin business cache calendar cambma casenais- catalogs catapult cd-ripping ceac2013 cheatsheet chickistoast chiptune civil-war cl clothing cloud cms cocktail cocktailclub cocktails code code-compression comfortfood comiccon comments comparison computer concert confederacy contact contacts conversion coolhackbro credit css css-specificity culture custom customize daily-sites dailydeal dailyfail database datarage datepicker dave dbtechprom deal deal30 deals debt deficit delay denim design details dev development devopsisawasteland directory dmb dns dock documents domain domains donereading dotd drinkone drinksontap drop-shadow dyingera dynamodb ecig editor education eecms elizabeth elpelon em email ettajames events everassassins evercrew everparty evertrue exhausted expressionengine extensions facebook familytime fancyfriday fatt favicon festivalofsnow filter finance financial finerthings firefox firstdayofspring flash flashbackfriday flight forms forser framework free freefont freelance freeparking freshpot frostydelicious fugq fun funny futurecollaboration gallery gcal generator getb ghostbusters git gmail golden goldengiobes gonova googlemaps goptakeover gosox grid gropefree gtd hackbrown happy hard-drive hcr healthcare highlighter hipchatbeta hive hobokenfirefighters holycowthatischeap homeland housing how-to howto htaccess html html5 humor ical icann icons ifttt ilyemail images imap in inbox ink inspiration install installer internet invoice invoicing ios ipa iphone italics13 itswhatjedisdrink itunes jamaicaplain japanesewhisky javascript jazz jb job jobs joinus jp jquery julep julepshavesprung junkmail juno2015 justreadit katespade kickstarter kitchenci ladies lamb lambjam lamp language lastfm layout leadership leahsbach legal leopard letsdrink lgbtq library lifehacker lifehacks lightbox linguistics links listen loadtesting lookup loremipsum love loveatfirstclick mac mac-os-x mac-pro macstoriesdeals mail management maps mario markdown marketing markup martinimonday mashup matthews mbta menswear mezcal mlb mobile mod_rewrite mootools morethanjustadream moving mp3 mp3_ mtvoma music music_ musicmonday mysql nannannannnannan narro negroniweek nemo netneutrality newmastersounds newtown nexus nifty nintendo nra nutball12 obamacare occupy occupywallstreet ocearch oink oldfashioned on onebostonday onedollarwednesday onthebar ops opschef optimization optout organization oscars osx overflow p2p pagination pair pay-for-clicks pennyarcade performance personal phonebook photo photography photoshop php ping.fm plugin policy politics productivity psychology punchdrunkmonday quotes raid raisetherim read realestate recording records redwhiteandblue reference relaxation rememberthemilk repealday requiredreading reset resource rip roostboston rss rubyfornubies s/t sailing sandy sass sata saturdayselfie savejon savethedata savinglives science search selfie series shabbatshasnow sharing sharktracker shirts shoottothrill shopping skyfall smithandwollensky snes sobeautiful socialskills software sop sopa sound soundcloud soundtracking sprite sprites stacks standards startup startuplife starwars storage style stylus suits sunday supernatural swagapalooza swearing sync t-shirts tables tacky takemymoneyhbo taxes taxilicious tea-party techgivesback technology tedc13 templates testing text-shadow thankssteve the theamericans thebachelor thefreshgeek thenillseeyouinhell thething thickbox thirstboston thisishowyoudoit thorntonsthursday thumbnails tikituesday tips to tool toolbar tools toread trackback trackbacks tracking travel trees trending triplets trueblood truegame truepartner turducken tutorial tutorials tux tuxedo tv tweaks tweetfest09 twitter txjs typeface typography umbrellas upgrade usa usability useful usefulornifty utilities vacationgram veevee video videos vote vscocam weaselpecker web web-2.0 web-apps web-design web-development web-stuff web2.0 webdesign webdev wedding weeklywhiskey whackywavingflailingarmflailingtubeman whiskey whiskeylist whisky whiskylive whois whoyougoingtocall whoyougonnacall windows windsorcustom wine wingmanapproved wmda11 woc women wordpress workw wrong wtf wwbos wwdc wysiwym xact yelp youtube zeroday zombiejesus

Copy this bookmark:



description:


tags: