8287
showing only twitter [see all]
Twitter
RT : A new report says that Trump urged his team to violate the law and redirect Puerto Rico's disaster assistance money…
from twitter
4 days ago
Twitter
RT : the estimate is for the avg triplex built in Portland to be 1,000 sq ft and the avg fourplex 700 sq ft per home. R…
from twitter
4 days ago
Twitter
RT : Thinking about this Watergate-era Doonesbury cartoon this morning.
from twitter
4 days ago
Twitter
RT : Wow, is now run by a virulent homophobe who wants the government to control women's bodies and was the pri…
from twitter
4 days ago
Twitter
RT : I'm finally reading through the court filing in the Massachusetts Sackler case. It is staggering. The Sacklers want…
from twitter
4 days ago
Twitter
RT : EXCLUSIVE: Citigroup is the first major US bank to release an unadjusted pay gap figure. Women earn 29 percent less…
from twitter
4 days ago
Twitter
RT : I have a very cool new opening for an engineering manager to join a talented crew building compilers, tool…
from twitter
4 days ago
Twitter
RT : This thread is honkin incredible
from twitter
5 days ago
Twitter
RT : a great example of how
1) displacement and gentrification can and do happen without major developments
2) single-…
from twitter
5 days ago
Twitter
RT : Breaking: will build a new North American headquarters, with 550 jobs, at Assembly Row in Somerville, the lat…
from twitter
5 days ago
Twitter
Probably strengthening. Confronting emotional stances with rational facts/…
from twitter
5 days ago
Remove unused code  |  web.dev
RT : Tip: Chrome can measure how much unused JavaScript is on your page

DevTools > top-right me…
from twitter
6 days ago
Twitter
RT : Tip: Chrome can measure how much unused JavaScript is on your page

DevTools > top-right me…
from twitter
6 days ago
Twitter
RT : MBTA will later this month propose nearly 50 service changes that can be put in place quite quickly. Example here,…
from twitter
6 days ago
Twitter
RT : Any resource that is backed by an API can be turned into a Terraform provider. Watch 's HashiConf talk to…
from twitter
6 days ago
Twitter
RT : 60% of those with an income <$50k support congestion pricing in NYC and support goes down as income rises. Can we d…
from twitter
8 days ago
Twitter
RT : Oh, the irony: Kentucky Sen. Rand Paul, one of the fiercest political critics of socialized medicine, will travel t…
from twitter
8 days ago
Twitter
RT : It's sort of frustrating how AOC demonstrated the huge upside to getting left candidates into the legislature to re…
from twitter
8 days ago
Twitter
RT : the good place season 1: wow someone bad ended up in heaven what a crazy turn of events!
the good place season 3: T…
from twitter
8 days ago
Twitter
RT : Pro tip: if you have bad gut feelings or see red flags during an interview process, you should not rationalize them…
from twitter
8 days ago
Twitter
RT : Titus Kaphar took a painting that used to be on the wall of Yale’s Corporation room, showing Eliyu Yale with two ot…
from twitter
9 days ago
Twitter
RT : Some counterarguments to the "decongestion pricing is regressive" line.

Ten Things More Inequitable Than Road Pric…
from twitter
9 days ago
Twitter
RT : Hey, some news: my team at is hiring a release engineer! I need someone to help us move code into productio…
from twitter
9 days ago
Twitter
RT : Trump sold an estimated $35,000,000 worth of real estate while serving in the White House last year, according to a…
from twitter
9 days ago
Twitter
Caveat to this: he was a super problematic colonialist president, and these words are not perfect.

Still, somethin…
from twitter
9 days ago
Twitter
RT : If you ever asked yourself "Who the fuck would vote against giving people their goddamned back pay?", now you have…
from twitter
9 days ago
Twitter
RT : yaknow, is really good at words
from twitter
9 days ago
Twitter
RT : As an SRE, this terrifies me. It should terrify you.

ATC, who are already doing 6 days a week unpaid, are also pro…
from twitter
9 days ago
Twitter
RT : CTO Of Vizio confirms that Data collection in Smart TV's is now offsetting the cost of the hardware to the point th…
from twitter
9 days ago
Twitter
RT : Brief thread: This video is heartbreaking. It shows the origins of roadway widening without an understanding of the…
from twitter
9 days ago
Twitter
RT : I think I am finally ready to talk publicly about some of what happened to me in 2018. It's not a happy story, but…
from twitter
9 days ago
Twitter
RT : We MUST advocate for transit connections to Harvard, Kendall and the LMA, to alleviate congestion on the Turnpike.…
from twitter
10 days ago
Twitter
RT : So this is progress, but the hard work isn't over.

We MUST advocate for a fully-built West Station, as part of a…
from twitter
10 days ago
Jeff Byrnes on Instagram: “You tell ‘em Teddy.”
You tell ‘em Teddy. @ American Museum of Natural History
from twitter
10 days ago
Twitter
RT : The most depressing research paper of 2018? "The Mark of a Woman’s Record: Gender and Academic Performance in Hirin…
from twitter
12 days ago
Twitter
RT : Senate Republicans can use this map to see where their disabled and elderly constituents face eviction thanks to th…
from twitter
12 days ago
Twitter
RT : imagine if grocery shopping was like health care and you went home with a loaf of bread and gallon of milk that had…
from twitter
12 days ago
Jeff | Orleans
The & Greater Boston social! (@ Orleans in Somerville, MA)
YIMBY  from twitter
12 days ago
Twitter
RT : In Seattle, a red-light camera program led to 23% decline in collisions, while crashes involving pedestrians fell b…
from twitter
12 days ago
Twitter
RT : looking to do something new and exciting this year? live in the boston area? we're hiring infrastructure engineers…
from twitter
12 days ago
Twitter
RT : JUST IN: FDA says routine food inspections stopped because of shutdown, raising health concerns…
from twitter
12 days ago
Twitter
RT : We are seeking to establish a SomerVision 2040 committee. We have invited representatives of local organizations bu…
from twitter
13 days ago
Twitter
This. So much this.

It’s inconceivable to folks who lived here through the 80s & 90s (when…
from twitter
13 days ago
Twitter
RT : If you'd like `brew cleanup` to run automatically for a given formula after installation and periodically (ever 30…
from twitter
13 days ago
Twitter
RT : Homebrew 1.9.0! Beta Linux (and Windows 10) support, opt-in automatic `brew cleanup`, more bottles for everyone and…
from twitter
13 days ago
Twitter
RT : Today is the last day of unlimited free Flickr. If you don’t download your pics by Feb 5, THEY WILL DELETE THEM. TH…
from twitter
13 days ago
Twitter
RT : 45: I spoke w/past presidents—All support the wall
•Carter: No
•Clinton: No
•Bush: No
•Obama: No

45: Southern Bord…
from twitter
13 days ago
Twitter
I’d check the agenda for tonight! If you see something interesting, I encou…
from twitter
13 days ago
Twitter
RT : We’re cohosting a Greater Boston YIMBY social this Thursday, 6:30pm at with !

Please…
from twitter
14 days ago
Twitter
RT : I don't know how else to characterize him without writing an essay, but he was a textbook war profiteer and war cri…
from twitter
14 days ago
Twitter
RT : I'm a tech with the USDA. We're not allowed in our gov't greenhouses to water our plants. 3 months…
from twitter
14 days ago
Twitter
Swordfish steak + barley risotto with chorizo & roasted mushrooms

Might be the best thing wordsbyleah has ever coo…
from twitter
14 days ago
Twitter
RT : He’s almost got it!

Just a few corrections:
* Single-payer healthcare
* Ending unjust wars
* 70% *marginal* tax ra…
from twitter
14 days ago
Twitter
RT : Here's a useful counterintuitive fact: one 18 inch pizza has more 'pizza' than two 12 inch pizzas
from twitter
14 days ago
Twitter
RT : As a non-rich person I pay basically the same taxes living in the United States that I did living in Canada. In ret…
from twitter
14 days ago
Twitter
RT : "The easiest, cheapest way to ease commutes isn’t simply building new stuff on the edges and adding lanes on the in…
from twitter
15 days ago
Twitter
RT : Ironically, contrary to popular belief, it's actually *safer* for kids to be out and about today than it was in 198…
from twitter
15 days ago
Twitter
RT : Trump claimed without evidence that past presidents privately confided to him that they regret not building a borde…
from twitter
15 days ago
Twitter
RT : I want to see these patterns at other hospitals!

If you have an ER bill from the past five years, submit it to:…
from twitter
15 days ago
Twitter
I haven’t, since we don’t own any 4K-capable devices besides our Macs.

I’ve already pre-ordered a…
from twitter
15 days ago
Twitter
RT : The Republican platform in 1868:
Open borders
Free trade with Asia
Unrestricted immigration of all races
from twitter
15 days ago
Twitter
So I’m looking for my next job opportunity!

I had a great 2 ½ years at Dark Sky, and now it’s time to move on.

I’…
from twitter
15 days ago
Twitter
RT : article with CNT data for Seattle, showing that logarithmic curve. Adding 7 new ADUs per 21-house block…
from twitter
16 days ago
Twitter
RT : read this thread and then follow this guy
from twitter
16 days ago
Twitter
So how about we build new units for these millennials? FYI, I’m also a millennial…
from twitter
16 days ago
Jeff | The Burren
Here to see my old classmate ! (@ The Burren - in Somerville, MA)
from twitter
17 days ago
Twitter
RT : Why I love taxes & you do too:
from twitter
17 days ago
Twitter
RT : This is a good discussion of AOC's call for a top tax rate of 70-80%. Tl; dr: she's actually saying what top public…
from twitter
17 days ago
Twitter
RT : Who knew? ‘“I’ve been renting in Seattle since 2014, and this is the first time where I felt like I have negotiatin…
from twitter
17 days ago
Twitter
RT : In light of recent news regarding weather apps and location privacy, I'd like to take this opportunity to provide a…
from twitter
17 days ago
Twitter
RT : What does our 1st major bill, do?
1. Ban voter roll purging, increase voting rights
2. Expand automatic & onli…
HR1  from twitter
17 days ago
Twitter
RT : All of them, next question
from twitter
17 days ago
Ocasio-Cortez’s 70% Top Tax Rate Is a Moderate Policy
RT : AOC's 70% top tax rate is a moderate, evidence-based policy
from twitter
18 days ago
Twitter
RT : AOC's 70% top tax rate is a moderate, evidence-based policy
from twitter
18 days ago
Twitter
RT : Here's a fantastic thing I had no idea existed: Kanopy is like a public library for streaming. Using your local lib…
from twitter
18 days ago
Twitter
RT : Reminder that Anderson Cooper is a literal Vanderbilt in case you're wondering why he looks so disturbed about the…
from twitter
18 days ago
Twitter
RT : This is truly amazing. The Justice Department admits that, under Trump, it effectively made up and misstated inform…
from twitter
18 days ago
« earlier      
#blackfriday #dailydeal #gropefree #itunes #jb #netneutrality #starwars #swagapalooza #taxes #thenillseeyouinhell 101 1988ceo 2future4u 50onfirebos 50shadesofbrown 60toast 8217 about absolutelyyes accounting ads advice aeachi aggregator aggressivehospitality airline airstream ajax almostsisters alumnilove and apache apartments article articles awesome babyblock background band bargains bass batman bestpractice bigwreck bitters bittorrent blackfriday blessed blizzard2015 blockquote blog blogging blueprint bluetux bocouproost bodog bookmarks bosnow bosto boston bostonberkleereunion bostoneers bostonfest bostonstrong bourbon bowtie box-shadow branding brilliant browser burnnotice busin business cache calendar cambma casenais- catalogs catapult cd-ripping ceac2013 cheatsheet chickistoast chiptune civil-war cl clothing cloud cms cocktail cocktailclub cocktails code code-compression comfortfood comiccon comments comparison computer concert confederacy contact contacts conversion coolhackbro credit css css-specificity culture custom customize daily-sites dailydeal dailyfail database datarage datepicker dave dbtechprom deal deal30 deals debt deficit delay denim design details dev development devopsisawasteland directory dmb dns dock documents domain domains donereading dotd drinkone drinksontap drop-shadow dyingera dynamodb ecig editor education eecms elizabeth elpelon em email ettajames events everassassins evercrew everparty evertrue exhausted expressionengine extensions facebook familytime fancyfriday fatt favicon festivalofsnow filter finance financial finerthings firefox firstdayofspring flash flashbackfriday flight forms forser framework free freefont freelance freeparking freshpot frostydelicious fugq fun funny futurecollaboration gallery gcal generator getb ghostbusters git gmail golden goldengiobes gonova googlemaps goptakeover gosox grid gropefree gtd hackbrown happy hard-drive hcr healthcare highlighter hipchatbeta hive hobokenfirefighters holycowthatischeap homeland housing how-to howto htaccess html html5 humor ical icann icons ifttt ilyemail images imap in inbox ink inspiration install installer internet invoice invoicing ios ipa iphone italics13 itswhatjedisdrink itunes jamaicaplain japanesewhisky javascript jazz jb job jobs joinus jp jquery julep julepshavesprung junkmail juno2015 justreadit katespade kickstarter kitchenci ladies lamb lambjam lamp language lastfm layout leadership leahsbach legal leopard letsdrink lgbtq library lifehacker lifehacks lightbox linguistics links listen loadtesting lookup loremipsum love loveatfirstclick mac mac-os-x mac-pro macstoriesdeals mail management maps mario markdown marketing markup martinimonday mashup matthews mbta menswear mezcal mlb mobile mod_rewrite mootools morethanjustadream moving mp3 mp3_ mtvoma music music_ musicmonday mysql nannannannnannan narro negroniweek nemo netneutrality newmastersounds newtown nexus nifty nintendo nra nutball12 obamacare occupy occupywallstreet ocearch oink oldfashioned on onebostonday onedollarwednesday onthebar ops opschef optimization optout organization oscars osx overflow p2p pagination pair pay-for-clicks pennyarcade performance personal phonebook photo photography photoshop php ping.fm plugin policy politics productivity psychology punchdrunkmonday quotes raid raisetherim read realestate recording records redwhiteandblue reference relaxation rememberthemilk repealday requiredreading reset resource rip roostboston rss rubyfornubies s/t sailing sandy sass sata saturdayselfie savejon savethedata savinglives science search selfie series shabbatshasnow sharing sharktracker shirts shoottothrill shopping skyfall smithandwollensky snes sobeautiful socialskills software sop sopa sound soundcloud soundtracking sprite sprites stacks standards startup startuplife starwars storage style stylus suits sunday supernatural swagapalooza swearing sync t-shirts tables tacky takemymoneyhbo taxes taxilicious tea-party techgivesback technology tedc13 templates testing text-shadow thankssteve the theamericans thebachelor thefreshgeek thenillseeyouinhell thething thickbox thirstboston thisishowyoudoit thorntonsthursday thumbnails tikituesday tips to tool toolbar tools toread trackback trackbacks tracking travel trees trending triplets trueblood truegame truepartner turducken tutorial tutorials tux tuxedo tv tweaks tweetfest09 twitter txjs typeface typography umbrellas upgrade usa usability useful usefulornifty utilities vacationgram veevee video videos vote vscocam weaselpecker web web-2.0 web-apps web-design web-development web-stuff web2.0 webdesign webdev wedding weeklywhiskey whackywavingflailingarmflailingtubeman whiskey whiskeylist whisky whiskylive whois whoyougoingtocall whoyougonnacall windows windsorcustom wine wingmanapproved wmda11 woc women wordpress workw wrong wtf wwbos wwdc wysiwym xact yelp youtube zeroday zombiejesus

Copy this bookmark:



description:


tags: