6996
showing only twitter [see all]
Twitter
RT : We were proud to take & on an inaugural ride of the new Green Line cars this afternoon…
from twitter
yesterday
Twitter
by Dan Carlin. _Hours_ of amazing history material. The WWI series (“Blueprint for Armage…
from twitter
yesterday
Twitter
RT : Let's not wait for cities and towns to come to their senses voluntarily about the need for new housing. Sky-high pr…
from twitter
yesterday
Twitter
RT : There are 111 days until the midterm elections. Please—ignore the Trump Show, which is designed to distract and der…
from twitter
yesterday
Twitter
RT : 🚨🚨🚨 Trump's Federal Transit Administration is basically refusing to award the $2.6 billion Congress sent it for new…
from twitter
yesterday
Twitter
RT : One ZIP code, two neighborhoods. One has seen frantic new housing construction, while the other has not. One has se…
from twitter
2 days ago
Twitter
RT : If you think you're a progressive person, living in a high-opportunity US city, ask how 10 or 20 or 50 thousand cli…
from twitter
2 days ago
Twitter
RT : In 1975, the average home value in Mass was $33,701. Homeownership is out of reach for too many today unless we ref…
from twitter
2 days ago
Twitter
RT : Interesting experiment by in unfollowing everyone he followed on Twitter using CLI tools for backups and…
from twitter
2 days ago
Twitter
RT : Seeing a lot of excitement over California's greenhouse gas emissions falling to 1990 levels.

That's nothing!

UK…
from twitter
2 days ago
Twitter
RT : Worth recalling that Russia’s economy is smaller than *California’s* economy.
from twitter
2 days ago
Twitter
RT : This was a good idea! What happened to that? Oh yeah, Reagan, the war on drugs, etc.
from twitter
3 days ago
Twitter
RT : Wait, hold on, this is getting lost in the fire:

The NRA was LITERALLY colluding with a Russian spy and within 24…
from twitter
3 days ago
Twitter
RT : Raise your hand if you're perpetually stuck between sharing the latest barrage of horrible news but fear spreading…
from twitter
3 days ago
Twitter
RT : The world moves on without America.
from twitter
3 days ago
Twitter
RT : Excited to see that redevelopment of Whittier Street Apartments has started. When completed Whittier Street Apartme…
from twitter
3 days ago
Twitter
RT : Love these folks, and promotions making the Seaport more accessible. Besides $10 Tuesdays, now the ShowPlace ICON h…
from twitter
3 days ago
Twitter
RT : In 1975, families in MA could rent an apartment for $200. Today 2BR averages $1500. We need zoning and housing refo…
from twitter
3 days ago
Twitter
RT : This is how you do . There are hundreds of triple deckers that could come back onlin…
DevelopmentWithoutDisplacement  from twitter
3 days ago
Twitter
RT : Wow: The Census Bureau compared what people say their income is vs. their actual incomes.

They found that when wiv…
from twitter
3 days ago
Twitter
RT : Wait, so you're saying the National Rifle Association might have illegally cut a deal with an oppressive foreign go…
from twitter
3 days ago
Twitter
RT : dev/color is different.

Lots of tech Diversity and Inclusion work is non-black people, talking to other non-black…
from twitter
4 days ago
Tech For Campaigns
RT : Want to make a difference? is matching skilled tech volunteers to political campaigns. Join:
from twitter
4 days ago
Twitter
RT : NYC library card holders will be able to visit over 2 dozen museums & institutions for free, incl. the Whitney, the…
from twitter
4 days ago
Twitter
RT : plastic straw bans are, to me, a perfect example of misguided consumer-focused attempts to solve environmental prob…
from twitter
4 days ago
Twitter
RT : If you're upset at Trump and Putin for colluding to destroy democracy, just wait until you find out they are collud…
from twitter
4 days ago
Twitter
RT :

Running for office?
Pay attention & hire consultants w a REAL business background if you don’t know what t…
MaPoli  from twitter
4 days ago
Job Application for UI Designer, Design Systems Apprentice at GitHub
RT : The Design Systems team is looking for a UI Designer apprentice! 🌟

This is a new pr…
from twitter
4 days ago
Twitter
RT : The Design Systems team is looking for a UI Designer apprentice! 🌟

This is a new pr…
from twitter
4 days ago
Twitter
RT : This press conference is essentially an official welcome of further election interference, and a promise to run int…
from twitter
4 days ago
Twitter
RT : America is the world's largest weapons exporter. I was curious to see what this looks like over time, so I mapped t…
from twitter
4 days ago
Twitter
RT : If you work at Amazon, Google, Twitter, Facebook, or Microsoft, know that your labor is being used to fund large do…
from twitter
4 days ago
Twitter
RT : The mock-up of a new car has been unwrapped, and now it will be subjected to a thorough inspection by the…
RedLine  from twitter
4 days ago
Twitter
RT : Be the 300th person to demand transit equity & connectivity in Greater Boston. Support our plan; sign our petition…
from twitter
4 days ago
Twitter
RT : READ: Miami Police stop serious terrorist attack planned specifically against Jews … by an American NeoNazi. Seriou…
from twitter
4 days ago
Twitter
RT : This is insane. Ebay founder has been paying Glenn Greenwald up to $518,000 per annum to blog about a mythi…
from twitter
4 days ago
Twitter
RT : MSGA’s Andre Leroux on why the state should allow cities/towns to create community benefit districts: they offer a…
from twitter
4 days ago
Letter from Shenzhen
RT : “When I get back to San Francisco, I joke with people that I have not traveled in China — I have time-traveled.”
from twitter
4 days ago
Twitter
♫ My Top 5 artists: Rachel Z Trio (32), Rachel Z (22), Jesse Fischer (7), John Coltrane (3) & Cannonball Ad…
lastfm  from twitter
4 days ago
Twitter
RT : If you see plainclothes ICE agents confronting ppl w their fascist “show me your papers” bullshit on Sound Transit,…
from twitter
5 days ago
Twitter
RT : Heyyy, GitHub is starting an apprentice program! These positions are 6-month learning experiences for people with n…
from twitter
6 days ago
Twitter
RT : Hey everyone. Tell the and - no more broken promises. Tell them to build the Red to Blue Connector! E…
MBTA  from twitter
6 days ago
Twitter
RT : So this was intended as a funny tweet, but then my dude went & did math. It's not funny, because turns out it's tru…
from twitter
6 days ago
Twitter
RT : - You don’t have to be gay to call out homophobia.
- You don’t have to be black to call out racism.
- You don’t hav…
from twitter
6 days ago
Twitter
RT : 250 units on less than an acre of land near transit with no new parking. This is how we grow!
from twitter
6 days ago
Twitter
RT : We have drained billions and billions of dollars from Seattle's economy to build homes for cars that mostly sit emp…
from twitter
6 days ago
Untitled (https://punchdrink.com/articles/low-proof-approach-classic-cocktail-recipe/)
RT : The Mint Julep, Manhattan, Margarita and more, restyled as low-proof session cocktails:
from twitter
7 days ago
Twitter
RT : The Mint Julep, Manhattan, Margarita and more, restyled as low-proof session cocktails:
from twitter
7 days ago
Twitter
I _think_ there’s a misprint in this article:

It says that…
from twitter
7 days ago
Twitter
RT : Radical change is possible.
The mistake to let the car dominate public space can be fixed.
~Maliesingel, Utrecht
from twitter
7 days ago
Twitter
RT : I got my first strawless lid yesterday and immediately noticed how much thicker it was than the old lids. Turns out…
from twitter
7 days ago
Twitter
RT : Tip: Webpack supports performance budgets for sites 💰

You can..
✍️ Configure a max file size (e.g JS should be < s…
from twitter
7 days ago
Twitter
RT : 4 officers just showed up on my doorstep.

they showed their badges and asked to speak to someone inside my house.…
from twitter
7 days ago
Twitter
RT : $1,300 for brand new unsubsidized 2BR/2BA apartments in Minneapolis. This is the future YIMBYs want
from twitter
7 days ago
Twitter
RT : If you have been wondering why the work hasn’t begun it was delayed but is now expected to begin the week of July 2…
from twitter
7 days ago
Twitter
RT : We pulled off an enormous upset, against all established power and big money, because of a few groups and people th…
from twitter
8 days ago
Twitter
RT : This is a big deal. Let's make it less than once in a lifetime.
from twitter
8 days ago
Twitter
RT : A once in a lifetime opportunity for a pedestrianized Comm Av. Let's have events! Community ride, road race, street…
from twitter
8 days ago
Twitter
RT : This is hitting my sector - affordable housing industry - very hard. Talked to many colleagues experiencing cost ov…
from twitter
8 days ago
Twitter
RT : I will never understand the faugressive bashing of YIMBYs as supply siders for a gagillion reasons, but the first i…
from twitter
8 days ago
Twitter
RT : Sam Pizzigati: It's time for a maximum wage.
"No enterprise where workers would have to labor over a century to mak…
from twitter
8 days ago
Twitter
RT : I did a comparison of city street network orientations in major US cities, and now I've got a better sense of why I…
from twitter
9 days ago
Twitter
RT : Are you voting to uphold protections in ! Then add your name here & RT to spread the w…
Massachusetts  trans  YesOn3  from twitter
9 days ago
Categorized Tweets
RT : 🏛️ It's an election year!
👉🏾 Visit & enter your zipcode
🤷🏾‍♀️ What: It scans the Twitter ti…
from twitter
9 days ago
Twitter
RT : 🏛️ It's an election year!
👉🏾 Visit & enter your zipcode
🤷🏾‍♀️ What: It scans the Twitter ti…
from twitter
9 days ago
Twitter
RT : Just to sum up. 1) Facebook broke the law. 2) Cambridge Analytica broke the law. 3) Vote Leave broke the law. 4) Le…
from twitter
9 days ago
Twitter
RT : This is a thought provoking, borderline inspiring way to spend your next few minutes:
from twitter
9 days ago
Twitter
RT : Fellow programmers. Do you do code review? I bet you do.

Do you want to do it better? I found an amazing code revi…
from twitter
10 days ago
Twitter
RT : 443 homes are proposed on parcels around 60 Kilmarnock Street in the Fenway. The project will include 250 parking s…
from twitter
10 days ago
Twitter
Any chance you visited Musée de l'Orangerie? It’s tucked away at the far end of the Tuileries Grden fro…
from twitter
10 days ago
Twitter
RT : Are you an awesome company looking for a Director of Engineering? Lemme tell you about —but only if you’r…
from twitter
10 days ago
Twitter
RT : It's official: This November, vote YES ON 3 to uphold basic protections for our neighbors, family and…
transgender  from twitter
10 days ago
Twitter
RT : Roe vs. Wade is not about abortion. It's about women's fundamental human right to control their own bodies. There's…
from twitter
10 days ago
Twitter
RT : Want to present about your organizing campaign, research, or another topic at ? Call for Papers deadl…
YIMBYtown2018  from twitter
10 days ago
Twitter
RT : Reminder: don’t buy from Amazon this week if you can at all avoid it, and especially don’t order anything on Prime…
from twitter
10 days ago
« earlier      
#blackfriday #dailydeal #gropefree #itunes #jb #netneutrality #starwars #swagapalooza #taxes #thenillseeyouinhell 101 1988ceo 2future4u 50onfirebos 50shadesofbrown 60toast 8217 about absolutelyyes accounting ads advice aeachi aggregator aggressivehospitality airline airstream ajax almostsisters alumnilove and apache apartments article articles awesome babyblock background band bargains bass batman bestpractice bigwreck bitters bittorrent blackfriday blessed blizzard2015 blockquote blog blogging blueprint bluetux bocouproost bodog bookmarks bosnow bosto boston bostonberkleereunion bostoneers bostonfest bostonstrong bourbon bowtie box-shadow branding brilliant browser burnnotice busin business cache calendar cambma casenais- catalogs catapult cd-ripping ceac2013 cheatsheet chickistoast chiptune civil-war cl clothing cloud cms cocktail cocktailclub cocktails code code-compression comfortfood comiccon comments comparison computer concert confederacy contact contacts conversion coolhackbro credit css css-specificity culture custom customize daily-sites dailydeal dailyfail database datarage datepicker dave dbtechprom deal deal30 deals debt deficit delay denim design details dev development devopsisawasteland directory dmb dns dock documents domain domains donereading dotd drinkone drinksontap drop-shadow dyingera dynamodb ecig editor education eecms elizabeth elpelon em email ettajames events everassassins evercrew everparty evertrue exhausted expressionengine extensions facebook familytime fancyfriday fatt favicon festivalofsnow filter finance financial finerthings firefox firstdayofspring flash flashbackfriday flight forms forser framework free freefont freelance freeparking freshpot frostydelicious fugq fun funny futurecollaboration gallery gcal generator getb ghostbusters git gmail golden goldengiobes gonova googlemaps goptakeover gosox grid gropefree gtd hackbrown happy hard-drive hcr healthcare highlighter hipchatbeta hive hobokenfirefighters holycowthatischeap homeland housing how-to howto htaccess html html5 humor ical icann icons ifttt ilyemail images imap in inbox ink inspiration install installer internet invoice invoicing ios ipa iphone italics13 itswhatjedisdrink itunes jamaicaplain japanesewhisky javascript jazz jb job jobs joinus jp jquery julep julepshavesprung junkmail juno2015 justreadit katespade kickstarter kitchenci ladies lamb lambjam lamp language lastfm layout leadership leahsbach legal leopard letsdrink lgbtq library lifehacker lifehacks lightbox linguistics links listen loadtesting lookup loremipsum love loveatfirstclick mac mac-os-x mac-pro macstoriesdeals mail management maps mario markdown marketing markup martinimonday mashup matthews mbta menswear mezcal mlb mobile mod_rewrite mootools morethanjustadream moving mp3 mp3_ mtvoma music music_ musicmonday mysql nannannannnannan narro negroniweek nemo netneutrality newmastersounds newtown nexus nifty nintendo nra nutball12 obamacare occupy occupywallstreet ocearch oink oldfashioned on onebostonday onedollarwednesday onthebar ops opschef optimization optout organization oscars osx overflow p2p pagination pair pay-for-clicks pennyarcade performance personal phonebook photo photography photoshop php ping.fm plugin policy politics productivity psychology punchdrunkmonday quotes raid raisetherim read realestate recording records redwhiteandblue reference relaxation rememberthemilk repealday requiredreading reset resource rip roostboston rss rubyfornubies s/t sailing sandy sass sata saturdayselfie savejon savethedata savinglives science search selfie series shabbatshasnow sharing sharktracker shirts shoottothrill shopping skyfall smithandwollensky snes sobeautiful socialskills software sop sopa sound soundcloud soundtracking sprite sprites stacks standards startup startuplife starwars storage style stylus suits sunday supernatural swagapalooza swearing sync t-shirts tables tacky takemymoneyhbo taxes taxilicious tea-party techgivesback technology tedc13 templates testing text-shadow thankssteve the theamericans thebachelor thefreshgeek thenillseeyouinhell thething thickbox thirstboston thisishowyoudoit thorntonsthursday thumbnails tikituesday tips to tool toolbar tools toread trackback trackbacks tracking travel trees trending triplets trueblood truegame truepartner turducken tutorial tutorials tux tuxedo tv tweaks tweetfest09 twitter txjs typeface typography umbrellas upgrade usa usability useful usefulornifty utilities vacationgram veevee video videos vote vscocam weaselpecker web web-2.0 web-apps web-design web-development web-stuff web2.0 webdesign webdev wedding weeklywhiskey whackywavingflailingarmflailingtubeman whiskey whiskeylist whisky whiskylive whois whoyougoingtocall whoyougonnacall windows windsorcustom wine wingmanapproved wmda11 woc women wordpress workw wrong wtf wwbos wwdc wysiwym xact yelp youtube zeroday zombiejesus

Copy this bookmark:



description:


tags: